EIF4B

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA039072

 

Antibody HPA046164

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA039072 HPA046164 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

14 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

90 93 

Antigen sequence

PSWRSEETQERERSRTGSESSQTGTSTTSSRNARRRESEKSLENETLNKE
EDCHSPTSKPPKPDQPLKVMPAPPPKENAWVKRSSNPPAR
 
TTWHSNDDDVYRAPPIDRSILPTAPRAAREPNIDRSRLPKSPPYTAFLGN
LPYDVTEESIKEFFRGLNISAVRLPREPSNPERLKGFGYAEFE
 

Matching transcripts

EIF4B-001 - ENSP00000262056 [100%]
EIF4B-005 - ENSP00000412530 [100%]
EIF4B-007 - ENSP00000388806 [94%]
 EIF4B-001 - ENSP00000262056 [100%]
EIF4B-007 - ENSP00000388806 [100%]
EIF4B-014 - ENSP00000447192 [100%]
EIF4B-015 - ENSP00000449746 [100%]
EIF4B-016 - ENSP00000450324 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Application not done for this antibody. Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:40 

Literature conformity

 Consistent with gene/protein characterization data 

RNA consistency

 Mainly consistent with RNA expression data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line MCF7 shows positivity in cytoplasm.
More information
 Immunofluorescent staining of human cell line MCF7 shows positivity in cytoplasm.
More information
 

Antibody dilution

1:109 1:44 

Validation IF

Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. 

         siRNA

Image

  

Description

Application not done for this antibody. Signal downregulation > 25% by one siRNA.
More information
 

Antibody dilution

 1:44 

Validation siRNA

 Supportive: The siRNA validation is supportive. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

69.7, 69.2, 64.8 69.7, 69.2, 41.5, 31.2, 19.4 

Antibody dilution

1:250 1:220 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:6000 1:1800 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
EIF4B-001
 
EIF4B-005
 
EIF4B-007
 
EIF4B-014
 
EIF4B-015
 
EIF4B-016