RPL18

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA046572

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA046572 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

82 

Antigen sequence

KLKVCALRVTSRARSRILRAGGKILTFDQLALDSPKGCGTVLLSGPRKGR
EVYRHFGKAPGTPHSHTKPYVRSKGRKFERAR
 

Matching transcripts

RPL18-001 - ENSP00000447001 [100%]
RPL18-006 - ENSP00000084795 [100%]
RPL18-008 - ENSP00000449204 [100%]
RPL18-013 - ENSP00000447894 [100%]
RPL18-015 - ENSP00000446634 [96%]
RPL18-014 - ENSP00000449610 [83%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:500 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line HEK 293 shows positivity in nucleoli & cytoplasm.
More information
 

Antibody dilution

1:55 

Validation IF

Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

21.7, 21.6, 18.9, 18.8, 18.1, 14.5 

Antibody dilution

1:280 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2200 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
RPL18-001
 
RPL18-006
 
RPL18-008
 
RPL18-013
 
RPL18-014
 
RPL18-015