ERBB3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA045396

 

Antibody CAB025331

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 R&D systems
 

Product name

HPA045396 MAB348 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

12 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

95  

Antigen sequence

LATTTLGSALSLPVGTLNRPRGSQSLLSPSSGYMPMNQGNLGESCQESAV
SGSSERCPRPVSLHPMPRGCLASESSEGHVTGSEAELQEKVSMCR
 
 

Matching transcripts

ERBB3-001 - ENSP00000267101 [100%]
ERBB3-004 - ENSP00000448729 [100%]
ERBB3-005 - ENSP00000449129 [100%]
ERBB3-009 - ENSP00000448946 [100%]
ERBB3-024 - ENSP00000408340 [100%]
ERBB3-201 - ENSP00000399178 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts and Leydig cells.
More information
 Immunohistochemical staining of human kidney shows strong membranous and cytoplasmic positivity in renal tubular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:10 1:750 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

  

Description

 Immunofluorescent staining of human cell line U-2 OS shows positivity in plasma membrane & cytoskeleton (actin filaments).
More information
 

Antibody dilution

 1:188 

Validation IF

 Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

148.1, 141.8, 77.4, 71.6, 64.3, 50.7 148.1, 141.8, 101.8, 77.4, 71.6, 64.3, 50.7, 36.5, 20.1, 14.0, 13.3, 13.2, 4.8 

Antibody dilution

1:250 1:500 

Validation WB

Uncertain: No bands detected Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
ERBB3-001
 
ERBB3-004
 
ERBB3-005
 
ERBB3-009
 
ERBB3-024
 
ERBB3-201