SLK

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA015757

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA015757 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

142 

Antigen sequence

DLVSQETGEKEANIQAVDSEVGLTKEDTQEKLGEDDKTQKDVISNTSDVI
GTCEAADVAQKVDEDSAEDTQSNDGKEVVEVGQKLINKPMVGPEAGGTKE
VPIKEIVEMNEIEEGKNKEQAINSSENIMDINEEPGTTEGEE
 

Matching transcripts

SLK-001 - ENSP00000336824 [100%]
SLK-002 - ENSP00000358770 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human kidney shows cytoplasmic and membranous positivity in glomeruli.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:275 

Literature conformity

Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line A-431 shows positivity in plasma membrane & cytoplasm.
More information
 

Antibody dilution

1:43 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

142.7, 139.0 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:25000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
SLK-001
 
SLK-002