CDK13

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA059241

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA059241 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

109 

Antigen sequence

PLGGIQPSSQTIQPKVETDAAQAAVQSAFAVLLTQLIKAQQSKQKDVLLE
ERENGSGHEASLQLRPPPEPSTPVSGQDDLIQHQDMRILELTPEPDRPRI
LPPDQRPPE
 

Matching transcripts

CDK13-001 - ENSP00000181839 [100%]
CDK13-002 - ENSP00000340557 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human heart muscle shows weak cytoplasmic positivity in myocytes.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:1500 

Literature conformity

Partly consistent with gene/protein characterization data 

RNA consistency

Not done 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line HeLa shows positivity in the Golgi apparatus & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:200 

Validation IF

Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

 

Description

 

Target mass (kDa)

164.9, 158.4 

Antibody dilution

1:790 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:9450 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
CDK13-001
 
CDK13-002