RPS6KA2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA045061

 

Antibody HPA054237

 

Antibody CAB026243

 

Antibody CAB069428

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 R&D Systems
 AbFrontier
 

Product name

HPA045061 HPA054237 AF893 LF-MA0279 

Host species

Rabbit Rabbit Rabbit Mouse 

Clonality

pAb pAb msAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity Protein A/G 

Released in version

14 14 5 14 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein Recombinant protein 

Length (aa)

51 40   

Antigen sequence

MDLSMKKFAVRRFFSVYLRRKSRSKSSSLSRLEEEGVVKEIDISHHVKEG
F
 
VASSLIQEPSQQDLHKVPVHPIVQQLHGNNIHFTDGYEIK
 
 
 

Matching transcripts

RPS6KA2-001 - ENSP00000265678 [100%]
 RPS6KA2-001 - ENSP00000265678 [100%]
RPS6KA2-003 - ENSP00000427015 [100%]
RPS6KA2-005 - ENSP00000422435 [100%]
RPS6KA2-006 - ENSP00000422484 [100%]
RPS6KA2-007 - ENSP00000386050 [100%]
   

Other gene match

    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells.
More information
 Immunohistochemical staining of human vagina shows moderate cytoplasmic and nuclear membranous positivity in squamous epithelial cells.
More information
 Immunohistochemical staining of human rectum shows strong positivity in glandular cells.
More information
 Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal and glia cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:30 1:200 1:100 1:600 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Mainly consistent with RNA expression data Mainly consistent with RNA expression data Mainly consistent with RNA expression data Mainly consistent with RNA expression data 

         Immunofluorescence

Image

    

Description

Immunofluorescent staining of human cell line HeLa shows positivity in nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line HeLa shows positivity in nucleus.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. 

Antibody dilution

1:54 1:60 1:25  

Validation IF

Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody. Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody. Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody.  

         Western Blot

Image

    

Description

  Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

83.2 85.6, 84.0, 83.2, 73.1 85.6, 84.0, 83.2, 73.1, 19.2, 16.4, 14.6, 11.3, 4.3 85.6, 84.0, 83.2, 73.1, 19.2, 16.4, 14.6, 11.3, 4.3 

Antibody dilution

1:250 1:300 1:500 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Only bands not corresponding to the predicted size Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:3000 1:2400   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
RPS6KA2-001
 
RPS6KA2-003
 
RPS6KA2-005
 
RPS6KA2-006
 
RPS6KA2-007