TCF3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA049808

 

Antibody HPA062476

 

Antibody CAB018351

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA049808 HPA062476 sc-349 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

13 13 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Synthetic peptide 

Length (aa)

80 39  

Antigen sequence

RTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGLTQ
AGFLSGELALNSPGPLSPSGMKGTSQYYPS
 
LAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAGA
 
 

Matching transcripts

TCF3-001 - ENSP00000262965 [100%]
TCF3-002 - ENSP00000468487 [100%]
TCF3-201 - ENSP00000344375 [100%]
 TCF3-001 - ENSP00000262965 [100%]
TCF3-002 - ENSP00000468487 [100%]
TCF3-003 - ENSP00000378813 [100%]
TCF3-005 - ENSP00000396363 [100%]
TCF3-006 - ENSP00000466952 [100%]
TCF3-014 - ENSP00000468481 [100%]
TCF3-201 - ENSP00000344375 [100%]
TCF3-010 - ENSP00000467388 [85%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human testis shows strong nuclear positivity in a subset of cells in seminiferus ducts.
More information
 Immunohistochemical staining of human testis shows distinct nuclear positivity in cells in seminiferous ducts.
More information
 Immunohistochemical staining of human lymph node shows strong nuclear positivity in reaction center cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:120 1:100 1:375 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Mainly consistent with RNAseq data Consistent with RNAseq data Consistent with RNAseq data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line MCF7 shows positivity in nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. Immunofluorescent staining of human cell line MCF7 shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:36  1:94 

Validation IF

Supportive: The subcellular location is supported by literature.  Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

   

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

67.6, 67.3 68.5, 67.6, 67.3, 58.7, 22.5, 11.3, 9.3 68.5, 67.6, 67.3, 58.7, 22.5, 21.8, 20.1, 18.5, 18.1, 16.1, 11.3, 10.0, 9.3, 8.7, 5.5 

Antibody dilution

1:180 1:190 1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Uncertain: No bands detected Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:1450 1:3400  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
TCF3-001
 
TCF3-002
 
TCF3-003
 
TCF3-005
 
TCF3-006
 
TCF3-010
 
TCF3-014
 
TCF3-201