TCF3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA049808

 

Antibody CAB018351

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA049808 sc-349 

Host species

Rabbit Rabbit 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

12 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

80  

Antigen sequence

RTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGLTQ
AGFLSGELALNSPGPLSPSGMKGTSQYYPS
 
 

Matching transcripts

TCF3-001 - ENSP00000262965 [100%]
TCF3-002 - ENSP00000468487 [100%]
TCF3-201 - ENSP00000344375 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

 Immunohistochemical staining of human lymph node shows strong nuclear positivity in reaction center cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:375 

Validation IH

 Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

67.6, 67.3 68.5, 67.6, 67.3, 58.7, 22.5, 21.8, 20.1, 18.5, 18.1, 16.1, 11.3, 10.0, 9.3, 8.7, 5.5 

Antibody dilution

1:180 1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line MCF-7 shows positivity in nucleus but not nucleoli.
More information
  

Antibody dilution

1:36  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:1450  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 
TCF3-001
 
TCF3-002
 
TCF3-201