SREBF1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA043343

 

Antibody CAB005406

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA043343 sc-367 

Host species

Rabbit Rabbit 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

13 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

83  

Antigen sequence

SLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVV
DAEKLPINRLAAGSKAPASAQSRGEKRTAHNAI
 
 

Matching transcripts

SREBF1-002 - ENSP00000261646 [100%]
SREBF1-003 - ENSP00000348069 [100%]
SREBF1-021 - ENSP00000411516 [100%]
SREBF1-201 - ENSP00000345822 [100%]
SREBF1-202 - ENSP00000413389 [100%]
SREBF1-004 - ENSP00000379106 [93%]
SREBF1-018 - ENSP00000379100 [93%]
SREBF1-017 - ENSP00000463474 [80%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunofluorescence

Image

  

Description

Application not done for this antibody. Immunofluorescent staining of human cell line A-431 shows positivity in the Golgi apparatus.
More information
 

Antibody dilution

 1:50 

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

124.6, 121.7, 113.6, 95.9, 48.3, 33.2, 22.5, 6.4 124.6, 121.7, 113.6, 95.9, 48.3, 33.2, 22.5, 17.1, 12.0, 11.5, 6.4, 3.1 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected 

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.
More information
 Application not done for this antibody. 

Retrieval method

HIER pH6  

Antibody dilution

1:400  

Literature conformity

Partly consistent with extensive gene/protein characterization data  

RNA consistency

Mainly not consistent with RNAseq data  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:6000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
SREBF1-002
 
SREBF1-003
 
SREBF1-004
 
SREBF1-017
 
SREBF1-018
 
SREBF1-021
 
SREBF1-201
 
SREBF1-202