ACADVL

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA019006

 

Antibody HPA020595

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA019006 HPA020595 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

106 104 

Antigen sequence

KLIKHKKGIVNEQFLLQRLADGAIDLYAMVVVLSRASRSLSEGHPTAQHE
KMLCDTWCIEAAARIREGMAALQSDPWQQELYRNFKSISKALVERGGVVT
SNPLGF
 
VFFDGVRVPSENVLGEVGSGFKVAMHILNNGRFGMAAALAGTMRGIIAKA
VDHATNRTQFGEKIHNFGLIQEKLARMVMLQYVTESMAYMVSANMDQGAT
DFQI
 

Matching transcripts

ACADVL-001 - ENSP00000349297 [100%]
ACADVL-002 - ENSP00000344152 [100%]
ACADVL-007 - ENSP00000438689 [100%]
 ACADVL-001 - ENSP00000349297 [100%]
ACADVL-002 - ENSP00000344152 [100%]
ACADVL-007 - ENSP00000438689 [100%]
ACADVL-020 - ENSP00000462611 [86%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human adrenal gland shows strong cytoplasmic positivity in cortical cells.
More information
 Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:75 1:65 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A549 shows positivity in nucleus, nucleoli & mitochondria.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in mitochondria & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:71 1:20 

Validation IF

Supportive: The subcellular location is supported by literature. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

72.9, 70.4, 68.1 72.9, 70.4, 68.1, 22.0 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ACADVL-001
 
ACADVL-002
 
ACADVL-007
 
ACADVL-020