NSF

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA003154

 

Antibody CAB009324

 

Antibody CAB013645

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 SDIX
 

Product name

HPA003154 sc-15339 1974.00.02  

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G Affinity 

Released in version

3 3 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein Genetic immunization 

Length (aa)

111   

Antigen sequence

KVEVDMEKAESLQVTRGDFLASLENDIKPAFGTNQEDYASYIMNGIIKWG
DPVTRVLDDGELLVQQTKNSDRTPLVSVLLEGPPHSGKTALAAKIAEESN
FPFIKICSPDK
 
 
 

Matching transcripts

NSF-001 - ENSP00000381293 [100%]
NSF-005 - ENSP00000458221 [100%]
NSF-201 - ENSP00000225282 [100%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human testis shows cytoplasmic positivity in cells of seminiferus ducts.
More information
 Immunohistochemical staining of human testis shows distinct cytoplasmic positivity in cells in seminiferus ducts.
More information
 Immunohistochemical staining of human gall bladder shows distinct cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:25 1:20 1:3000 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Mainly not consistent with RNAseq data Not done Not done 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:10   

Validation IF

Supportive: The subcellular location is supported by literature.   

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401861)
More information
 Lane 1: Marker [kDa] 219, 111, 83, 48, 32, 26, 17
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

82.6, 82.1, 71.6 82.6, 82.1, 71.6, 20.0, 18.0, 15.2, 8.9, 5.0 82.6, 82.1, 71.6, 20.0, 18.0, 15.2, 8.9, 5.0 

Antibody dilution

1:250 1:500 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:500   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
NSF-001
 
NSF-005
 
NSF-201