ATP2A3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA007180

 

Antibody CAB010882

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 SIGMA
 

Product name

HPA007180 A7952 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

4 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

101  

Antigen sequence

SRDRKSMSVYCTPTRPHPTGQGSKMFVKGAPESVIERCSSVRVGSRTAPL
TPTSREQILAKIRDWGSGSDTLRCLALATRDAPPRKEDMELDDCSKFVQY
E
 
 

Matching transcripts

ATP2A3-001 - ENSP00000380234 [100%]
ATP2A3-002 - ENSP00000380236 [100%]
ATP2A3-004 - ENSP00000380229 [100%]
ATP2A3-005 - ENSP00000353072 [100%]
ATP2A3-015 - ENSP00000301387 [100%]
ATP2A3-201 - ENSP00000312577 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human cerebellum shows strong nucleolar and cytoplasmic positivity in purkinje cells.
More information
 Immunohistochemical staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:80 1:350 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Western Blot

Image

  

Description

  

Target mass (kDa)

114.9, 114.0, 112.5, 109.3, 109.1 114.9, 114.0, 112.5, 109.3, 109.1, 24.2, 17.2, 15.8 

Antibody dilution

1:250 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
ATP2A3-001
 
ATP2A3-002
 
ATP2A3-004
 
ATP2A3-005
 
ATP2A3-015
 
ATP2A3-201