MARK3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA024652

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA024652 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

150 

Antigen sequence

QSPHHKVQRSVSSSQKQRRYSDHAGPAIPSVVAYPKRSQTSTADSDLKED
GISSRKSSGSAVGGKGIAPASPMLGNASNPNKADIPERKKSSTVPSSNTA
SGGMTRRNTYVCSERTTADRHSVIQNGKENSTIPDQRTPVASTHSISSAA
 

Matching transcripts

MARK3-001 - ENSP00000411397 [99%]
MARK3-002 - ENSP00000402104 [99%]
MARK3-003 - ENSP00000408092 [99%]
MARK3-004 - ENSP00000303698 [99%]
MARK3-005 - ENSP00000216288 [99%]
MARK3-006 - ENSP00000450772 [99%]
MARK3-007 - ENSP00000450460 [99%]
MARK3-026 - ENSP00000335347 [99%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:175 

Literature conformity

Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in nuclear membrane.
More information
 

Antibody dilution

1:100 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

87.0, 84.5, 84.0, 83.3, 81.5, 79.9, 74.2, 56.6 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
MARK3-001
 
MARK3-002
 
MARK3-003
 
MARK3-004
 
MARK3-005
 
MARK3-006
 
MARK3-007
 
MARK3-026