BCAP29

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA029215

 

Antibody HPA049694

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA029215 HPA049694 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

54 61 

Antigen sequence

LITQLAKELSNKGVLKTQAENTNKAAKKFMEENEKLKRILKSHGKDEECV
LEAE
 
KLVEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSE
LQDRLERGNKK
 

Matching transcripts

BCAP29-001 - ENSP00000005259 [100%]
BCAP29-002 - ENSP00000409350 [100%]
BCAP29-005 - ENSP00000418816 [100%]
BCAP29-013 - ENSP00000400718 [100%]
BCAP29-014 - ENSP00000414164 [100%]
BCAP29-015 - ENSP00000418993 [100%]
BCAP29-016 - ENSP00000368412 [100%]
BCAP29-017 - ENSP00000419681 [100%]
BCAP29-201 - ENSP00000368414 [100%]
BCAP29-202 - ENSP00000368416 [100%]
 BCAP29-001 - ENSP00000005259 [100%]
BCAP29-015 - ENSP00000418993 [100%]
BCAP29-016 - ENSP00000368412 [100%]
BCAP29-017 - ENSP00000419681 [87%]
BCAP29-002 - ENSP00000409350 [85%]
BCAP29-013 - ENSP00000400718 [85%]
BCAP29-014 - ENSP00000414164 [85%]
BCAP29-201 - ENSP00000368414 [85%]
BCAP29-202 - ENSP00000368416 [85%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts.
More information
 Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:60 1:250 

Literature conformity

Consistent with gene/protein characterization data Consistent with gene/protein characterization data 

RNA consistency

Consistent with RNAseq data Consistent with RNAseq data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

40.8, 34.1, 28.3, 27.0, 22.9, 18.9, 18.0, 17.4 40.8, 34.1, 28.3, 27.0, 18.9, 18.0, 17.4 

Antibody dilution

1:250 1:870 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:6950 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunofluorescence

Image

  

Description

Application not done for this antibody. Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm.
More information
 

Antibody dilution

 1:172 

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available. 
 

ANTIGEN VIEW

? »
 
 
 
BCAP29-001
 
BCAP29-002
 
BCAP29-005
 
BCAP29-013
 
BCAP29-014
 
BCAP29-015
 
BCAP29-016
 
BCAP29-017
 
BCAP29-201
 
BCAP29-202