KLHL20

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA025034

 

Antibody HPA053704

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA025034 HPA053704 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

96 78 

Antigen sequence

GRDDTTELSSAERYNPRTNQWSPVVAMTSRRSGVGLAVVNGQLMAVGGFD
GTTYLKTIEVFDPDANTWRLYGGMNYRRLGGGVGVIKMTHCESHIW
 
NIRPGETGMDVTSRCTLGDPNKLPEGVPQPARMPYISDKHPRQTLEVINL
LRKHRELCDVVLVVGAKKIYAHRVILSA
 

Matching transcripts

KLHL20-001 - ENSP00000209884 [100%]
KLHL20-201 - ENSP00000443121 [100%]
 KLHL20-001 - ENSP00000209884 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human gall bladder shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:15 1:1500 

Literature conformity

No avaliable characterization data No avaliable characterization data 

RNA consistency

Mainly consistent with RNAseq data Mainly consistent with RNAseq data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm & the Golgi apparatus.
More information
 Application not done for this antibody. 

Antibody dilution

1:10  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

68.0, 46.5 68.0 

Antibody dilution

1:250 1:350 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:2800 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
KLHL20-001
 
KLHL20-201