MAP2K7

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001633

 

Antibody CAB004262

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA001633 sc-25288 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

2 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

121  

Antigen sequence

LVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELAT
GQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRK
RPKYNKLLEHSFIKRYETMEV
 
 

Matching transcripts

MAP2K7-002 - ENSP00000381066 [99%]
MAP2K7-003 - ENSP00000381070 [99%]
MAP2K7-201 - ENSP00000443946 [99%]
MAP2K7-001 - ENSP00000381068 [94%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
More information
 Immunohistochemical staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:15 1:150 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Testis
More information
 

Target mass (kDa)

51.8, 49.1, 48.2, 47.5 51.8, 49.1, 48.2, 47.5 

Antibody dilution

1:250 1:500 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
MAP2K7-001
 
MAP2K7-002
 
MAP2K7-003
 
MAP2K7-201