FGFR1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA056402

 

Antibody CAB033614

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA056402 sc-57132 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

12 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

54  

Antigen sequence

LPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQLAES
NRTR
 
 

Matching transcripts

FGFR1-001 - ENSP00000380280 [100%]
FGFR1-002 - ENSP00000432972 [100%]
FGFR1-009 - ENSP00000433163 [100%]
FGFR1-012 - ENSP00000380302 [100%]
FGFR1-015 - ENSP00000400708 [100%]
FGFR1-020 - ENSP00000380297 [100%]
FGFR1-036 - ENSP00000434712 [100%]
FGFR1-201 - ENSP00000340636 [100%]
FGFR1-202 - ENSP00000393312 [100%]
FGFR1-203 - ENSP00000400162 [100%]
FGFR1-003 - ENSP00000337247 [96%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human kidney shows strong membranous positivity in cells in tubules.
More information
 Immunohistochemical staining of human kidney shows cytoplasmic, membranous and nuclear positivity in cells in tubules.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:100 1:25 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

95.3, 91.9, 91.8, 91.7, 91.6, 90.6, 33.3, 16.5, 11.9 95.3, 91.9, 91.8, 91.7, 91.6, 90.6, 82.2, 82.0, 81.9, 33.3, 16.5, 16.4, 16.0, 15.7, 15.2, 11.9, 9.5, 6.8, 6.2, 0.1 

Antibody dilution

1:230 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 « 
 
FGFR1-001
 
FGFR1-002
 
FGFR1-003
 
FGFR1-009
 
FGFR1-012
 
FGFR1-015
 
FGFR1-020
 
FGFR1-036
 
FGFR1-201
 
FGFR1-202
 
FGFR1-203
 
 »