FKBP6

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA061109

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA061109 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

85 

Antigen sequence

KPNYAYGTLGCPPLIPPNTTVLFEIELLDFLDCAESDKFCALSAEQQDQF
PLQKVLKVAATEREFGNYLFRQNRFYDAKVRYKRA
 

Matching transcripts

FKBP6-001 - ENSP00000252037 [100%]
FKBP6-002 - ENSP00000416277 [100%]
FKBP6-003 - ENSP00000394952 [100%]
FKBP6-005 - ENSP00000403908 [93%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in a subset of cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:250 

Literature conformity

Partly consistent with gene/protein characterization data 

RNA consistency

Mainly not consistent with RNAseq data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY418553)
More information
 

Target mass (kDa)

37.2, 36.9, 33.6, 22.3 

Antibody dilution

1:125 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
FKBP6-001
 
FKBP6-002
 
FKBP6-003
 
FKBP6-005