UBE2K

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA028869

 

Antibody CAB033212

 

Antibody CAB033515

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 Santa Cruz Biotechnology
 

Product name

HPA028869 sc-50733 sc-50736 

Host species

Rabbit Goat Goat 

Clonality

pAb msAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity Affinity 

Released in version

6 6 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide Synthetic peptide 

Length (aa)

110   

Antigen sequence

VTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQ
NPEMFKQTARLWAHVYAGAPVSSPEYTKKIENLCAMGFDRNAVIVALSSK
SWDVETATEL
 
 
 

Matching transcripts

UBE2K-001 - ENSP00000261427 [100%]
UBE2K-005 - ENSP00000421203 [100%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human lateral ventricle shows strong cytoplasmic positivity in neuronal cells.
More information
 Immunohistochemical staining of human testis shows moderate cytoplasmic and nuclear positivity in cells of seminiferus ducts.
More information
 Immunohistochemical staining of human pancreas shows strong cytoplasmic and nuclear positivity in exocrine glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:1100 1:10 1:10 

Literature conformity

Consistent with gene/protein characterization data Consistent with gene/protein characterization data Consistent with gene/protein characterization data 

RNA consistency

Not done Not done Not done 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:100   

Validation IF

Supportive: The subcellular location is supported by literature.   

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY417371)
More information
  Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

22.4, 16.6 22.4, 17.4, 16.6, 15.8, 14.0, 4.8 22.4, 17.4, 16.6, 15.8, 14.0, 4.8 

Antibody dilution

1:250 1:500 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:30000   

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).   
 

ANTIGEN VIEW

? »
 
 
 
UBE2K-001
 
UBE2K-005