ADCY2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA038015

 

Antibody HPA038483

 

Antibody CAB031482

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA038015 HPA038483 sc-587 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

7 7 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Synthetic peptide 

Length (aa)

86 62  

Antigen sequence

HHRDSMTTENGKISTTDVPMGQHNFQNRTLRTKSQKKRFEEELNERMIQA
IDGINAQKQWLKSEDIQRISLLFYNKVLEKEYRATA
 
HISSVTLEHLNGAYKVEEGDGDIRDPYLKQHLVKTYFVINPKGERRSPQH
LFRPRHTLDGAK
 
 

Matching transcripts

ADCY2-001 - ENSP00000342952 [100%]
ADCY2-201 - ENSP00000444803 [100%]
 ADCY2-001 - ENSP00000342952 [100%]
ADCY2-201 - ENSP00000444803 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.
More information
 Immunohistochemical staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.
More information
 Immunohistochemical staining of human testis shows strong positivity in leydig cells and in a fraction of cells in seminiferus ducts.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:25 1:15 1:175 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

123.6, 103.2 123.6, 103.2 123.6, 103.2, 11.5, 8.4 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
ADCY2-001
 
ADCY2-201