ADCYAP1R1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA049877

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA049877 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

11 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

37 

Antigen sequence

SDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWD
 

Matching transcripts

ADCYAP1R1-001 - ENSP00000306620 [100%]
ADCYAP1R1-002 - ENSP00000387335 [100%]
ADCYAP1R1-003 - ENSP00000379514 [100%]
ADCYAP1R1-004 - ENSP00000386395 [100%]
ADCYAP1R1-006 - ENSP00000400893 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human cerebral cortex shows moderate positivity in neuropil.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:10 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

59.6, 56.5, 53.3, 51.0, 8.1 

Antibody dilution

1:90 

Validation WB

Uncertain: No bands detected 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:750 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
ADCYAP1R1-001
 
ADCYAP1R1-002
 
ADCYAP1R1-003
 
ADCYAP1R1-004
 
ADCYAP1R1-006