EPHA6

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA007397

 

Antibody HPA058047

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA007397 HPA058047 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

82 49 

Antigen sequence

EASIMGQFDHPNIIRLEGVVTKRSFPAIGVEAFCPSFLRAGFLNSIQAPH
PVPGGGSLPPRIPAGRPVMIVVEYMENGSLDS
 
PGDCSHVSNNQVVLLDTTTVLGELGWKTYPLNGWDAITEMDEHNRPIHT
 

Matching transcripts

EPHA6-002 - ENSP00000374323 [100%]
EPHA6-006 - ENSP00000423950 [100%]
EPHA6-007 - ENSP00000421711 [100%]
EPHA6-008 - ENSP00000424638 [100%]
EPHA6-201 - ENSP00000403100 [100%]
 EPHA6-001 - ENSP00000420598 [100%]
EPHA6-002 - ENSP00000374323 [100%]
EPHA6-005 - ENSP00000425132 [100%]
EPHA6-202 - ENSP00000439758 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
More information
  

Retrieval method

HIER pH6  

Antibody dilution

1:10  

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data  

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:20 1:30 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400431)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

126.6, 44.5, 37.3, 26.9 126.6, 61.0, 37.1, 32.3 

Antibody dilution

1:250 1:100 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:1100 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
EPHA6-001
 
EPHA6-002
 
EPHA6-005
 
EPHA6-006
 
EPHA6-007
 
EPHA6-008
 
EPHA6-201
 
EPHA6-202