RNF13

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA008709

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA008709 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

101 

Antigen sequence

PCSHAYHCKCVDPWLTKTKKTCPVCKQKVVPSQGDSDSDTDSSQEENEVT
EHTPLLRPLASVSAQSFGALSESRSHQNMTESSDYEEDDNEDTDSSDAEN
E
 

Matching transcripts

RNF13-001 - ENSP00000376628 [100%]
RNF13-002 - ENSP00000355268 [100%]
RNF13-003 - ENSP00000341361 [100%]
RNF13-018 - ENSP00000420510 [96%]
RNF13-007 - ENSP00000420667 [95%]
RNF13-017 - ENSP00000418863 [94%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human vulva/anal skin shows strong nuclear and cytoplasmic positivity in squamous epithelial cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:10 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY416058)
More information
 

Target mass (kDa)

42.8, 29.7, 26.4, 26.3, 20.8 

Antibody dilution

1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
RNF13-001
 
RNF13-002
 
RNF13-003
 
RNF13-007
 
RNF13-017
 
RNF13-018