CYLD

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA050095

 

Antibody CAB011713

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Abcam plc
 

Product name

HPA050095 ab33929 

Host species

Rabbit Rabbit 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

12 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

84  

Antigen sequence

PPLEINSRVSLKVGETIESGTVIFCDVLPGKESLGYFVGVDMDNPIGNWD
GRFDGVQLCSFACVESTILLHINDIIPESVTQER
 
 

Matching transcripts

CYLD-001 - ENSP00000457576 [100%]
CYLD-002 - ENSP00000462134 [100%]
CYLD-005 - ENSP00000381574 [100%]
CYLD-006 - ENSP00000454515 [100%]
CYLD-009 - ENSP00000456488 [100%]
CYLD-003 - ENSP00000308928 [97%]
CYLD-010 - ENSP00000392025 [97%]
CYLD-201 - ENSP00000445447 [97%]
CYLD-007 - ENSP00000456912 [92%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
More information
 Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:250 1:50 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 219, 111, 83, 48, 32, 26, 17
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

107.3, 107.0, 101.9, 87.4, 33.9 107.3, 107.0, 101.9, 87.4, 33.9, 18.9, 11.9, 7.2, 4.0 

Antibody dilution

1:450 1:500 

Validation WB

Uncertain: No bands detected Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in centrosome & nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. 

Antibody dilution

1:90  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3600  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 
CYLD-001
 
CYLD-002
 
CYLD-003
 
CYLD-005
 
CYLD-006
 
CYLD-007
 
CYLD-009
 
CYLD-010
 
CYLD-201