CYLD

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA050095

 

Antibody HPA058854

 

Antibody CAB011713

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Abcam plc
 

Product name

HPA050095 HPA058854 ab33929 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

12 14 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Synthetic peptide 

Length (aa)

84 92  

Antigen sequence

PPLEINSRVSLKVGETIESGTVIFCDVLPGKESLGYFVGVDMDNPIGNWD
GRFDGVQLCSFACVESTILLHINDIIPESVTQER
 
FVDEKDVVEINEKFTELLLAITNCEERFSLFKNRNRLSKGLQIDVGCPVK
VQLRSGEEKFPGVVRFRGPLLAERTVSGIFFGVELLEEGRGQ
 
 

Matching transcripts

CYLD-001 - ENSP00000457576 [100%]
CYLD-002 - ENSP00000462134 [100%]
CYLD-005 - ENSP00000381574 [100%]
CYLD-006 - ENSP00000454515 [100%]
CYLD-009 - ENSP00000456488 [100%]
CYLD-003 - ENSP00000308928 [97%]
CYLD-010 - ENSP00000392025 [97%]
CYLD-007 - ENSP00000456912 [92%]
 CYLD-001 - ENSP00000457576 [100%]
CYLD-002 - ENSP00000462134 [100%]
CYLD-003 - ENSP00000308928 [100%]
CYLD-005 - ENSP00000381574 [100%]
CYLD-006 - ENSP00000454515 [100%]
CYLD-007 - ENSP00000456912 [100%]
CYLD-009 - ENSP00000456488 [100%]
CYLD-010 - ENSP00000392025 [100%]
CYLD-011 - ENSP00000457108 [91%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
More information
 Application not done for this antibody. Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
More information
 

Retrieval method

HIER pH6  HIER pH6 

Antibody dilution

1:250  1:50 

Literature conformity

Consistent with extensive gene/protein characterization data  Consistent with extensive gene/protein characterization data 

RNA consistency

Not done  Not done 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in centrosome & nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line SiHa shows positivity in centrosome.
More information
 Application not done for this antibody. 

Antibody dilution

1:90 1:40  

Validation IF

Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody.  

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 219, 111, 83, 48, 32, 26, 17
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

107.3, 107.0, 101.9, 87.4, 33.9 107.3, 107.0, 101.9, 87.4, 33.9, 18.9 107.3, 107.0, 101.9, 87.4, 33.9, 18.9, 11.9, 7.2, 4.0 

Antibody dilution

1:450 1:130 1:500 

Validation WB

Uncertain: No bands detected Uncertain: No bands detected Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3600 1:1600  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CYLD-001
 
CYLD-002
 
CYLD-003
 
CYLD-005
 
CYLD-006
 
CYLD-007
 
CYLD-009
 
CYLD-010
 
CYLD-011