SEH1L

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA039964

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA039964 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

8 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

72 

Antigen sequence

LMLATCSADGIVRIYEAPDVMNLSQWSLQHEISCKLSCSCISWNPSSSRA
HSPMIAVGSDDSSPNAMAKVQI
 

Matching transcripts

SEH1L-001 - ENSP00000262124 [100%]
SEH1L-002 - ENSP00000382779 [100%]
SEH1L-006 - ENSP00000467276 [100%]
SEH1L-007 - ENSP00000466959 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:100 

Literature conformity

Not consistent with gene/protein characterization data 

RNA consistency

Not done 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403101)
More information
 

Target mass (kDa)

46.6, 39.6, 21.0, 17.6 

Antibody dilution

1:250 

Validation WB

Uncertain: No bands detected 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
SEH1L-001
 
SEH1L-002
 
SEH1L-006
 
SEH1L-007