MAP3K4

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA007625

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA007625 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

131 

Antigen sequence

KDREQRGQENTSGFWLNRSNELIWLELQAWHAGRTINDQDFFLYTARQAI
PDIINEILTFKVDYGSFAFVRDRAGFNGTSVEGQCKATPGTKIVGYSTHH
EHLQRQRVSFEQVKRIMELLEYIEALYPSLQ
 

Matching transcripts

MAP3K4-001 - ENSP00000375986 [100%]
MAP3K4-002 - ENSP00000355886 [100%]
MAP3K4-004 - ENSP00000446303 [100%]
MAP3K4-005 - ENSP00000445018 [100%]
MAP3K4-006 - ENSP00000355887 [100%]
MAP3K4-007 - ENSP00000297332 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human pancreas shows strong nuclear and moderate cytoplasmic positivity in exocrine glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:500 

Literature conformity

No avaliable characterization data 

RNA consistency

Not done 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:40 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

181.7, 181.2, 177.0, 176.6, 163.0, 71.7 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
MAP3K4-001
 
MAP3K4-002
 
MAP3K4-004
 
MAP3K4-005
 
MAP3K4-006
 
MAP3K4-007