AKR1B1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA026425

 

Antibody HPA052751

 

Antibody CAB018773

 

Antibody CAB027391

 

Antibody CAB047353

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 NCI-CPTC
 NCI-CPTC
 

Product name

HPA026425 HPA052751 sc-33219 CPTC-AKR1B1-3 627A16.1 

Host species

Rabbit Rabbit Rabbit Mouse Mouse 

Clonality

pAb pAb pAb mAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G Protein A/G Protein A/G 

Released in version

6 13 4 6 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein Recombinant protein Recombinant protein 

Length (aa)

51 46    

Antigen sequence

CTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGN
V
 
VTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDY
 
 
 
 

Matching transcripts

AKR1B1-001 - ENSP00000285930 [100%]
AKR1B1-002 - ENSP00000414399 [100%]
 AKR1B1-001 - ENSP00000285930 [100%]
    

Other gene match

     

ANTIBODY VALIDATION

         Immunohistochemistry

Image

     

Description

Immunohistochemical staining of human placenta shows strong cytoplasmic and nuclear positivity in trophoblasts.
More information
 Application not done for this antibody. Immunohistochemical staining of human pancreas shows cytoplasmic and nuclear positivity in exocrine glandular cells.
More information
 Immunohistochemical staining of human placenta shows strong cytoplasmic and nuclear positivity in cytotrophoblasts.
More information
 Application not done for this antibody. 

Retrieval method

HIER pH6  HIER pH6 HIER pH6  

Antibody dilution

1:1200  1:50 1:1500  

Literature conformity

Consistent with extensive gene/protein characterization data  Consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data  

RNA consistency

Not done  Not done Not done  

         Western Blot

Image

     

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

35.9, 29.4 35.9 35.9, 29.4, 11.0 35.9, 29.4, 11.0 35.9, 29.4, 11.0 

Antibody dilution

1:250 1:80 1:500 1:500 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Immunofluorescence

Image

     

Description

Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line A549 shows positivity in cytoplasm.
More information
 Application not done for this antibody. Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:50 1:8  1:400 1:2000 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature.  Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Protein array

Image

     

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:3000 1:650    

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen.    
 

ANTIGEN VIEW

? »
 
 
 
AKR1B1-001
 
AKR1B1-002