CTTN

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA057242

 

Antibody CAB011235

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 SDIX
 

Product name

HPA057242 2190.00.02 

Host species

Rabbit Rabbit 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

13 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Genetic immunization 

Length (aa)

76  

Antigen sequence

GFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYKTGFGGKFGVQSERQ
DSAAVGFDYKEKLAKHESQQDYSKGF
 
 

Matching transcripts

CTTN-002 - ENSP00000301843 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human stomach, lower shows strong cytoplasmic and membranous positivity in glandular cells.
More information
 Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:115 1:500 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Mainly consistent with RNAseq data Consistent with RNAseq data 

         Western Blot

Image

  

Description

  

Target mass (kDa)

61.6 71.0, 61.6, 57.5, 35.3, 29.6, 25.0, 14.3, 8.8, 8.3, 5.8 

Antibody dilution

1:110 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:1200  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CTTN-002