DNM1L

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA039324

 

Antibody CAB009952

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA039324 sc-32898 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

12 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

81  

Antigen sequence

EADGKVASGGGGVGDGVQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMP
ASPQKGHAVNLLDVPVPVARKLSAREQRDCE
 
 

Matching transcripts

DNM1L-008 - ENSP00000448610 [100%]
DNM1L-010 - ENSP00000370388 [100%]
DNM1L-004 - ENSP00000350948 [95%]
DNM1L-005 - ENSP00000266481 [95%]
DNM1L-001 - ENSP00000415131 [94%]
DNM1L-002 - ENSP00000449089 [88%]
DNM1L-003 - ENSP00000450399 [88%]
DNM1L-201 - ENSP00000404160 [88%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human lateral ventricle shows strong nuclear positivity in glial cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:125 1:65 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm & vesicles.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
More information
 

Antibody dilution

1:33 1:16 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 219, 111, 83, 48, 32, 26, 17
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

83.4, 82.1, 81.9, 80.5, 79.6, 79.4, 78.1, 60.0 83.4, 82.1, 81.9, 80.5, 79.6, 79.4, 78.1, 60.0, 29.0, 19.9, 19.1, 18.4, 17.3, 13.0, 10.5, 5.9, 5.5 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 
DNM1L-001
 
DNM1L-002
 
DNM1L-003
 
DNM1L-004
 
DNM1L-005
 
DNM1L-008
 
DNM1L-010
 
DNM1L-201