KIF16B

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA051198

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA051198 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

91 

Antigen sequence

KLVNLEKDLVQQKDILKKEVQEEQEILECLKCEHDKESRLLEKHDESVTD
VTEVPQDFEKIKPVEYRLQYKERQLQYLLQNHLPTLLEEKQ
 

Matching transcripts

KIF16B-001 - ENSP00000384164 [100%]
KIF16B-003 - ENSP00000347076 [100%]
KIF16B-201 - ENSP00000347995 [100%]
KIF16B-202 - ENSP00000367242 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells of tubules.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:600 

Literature conformity

No avaliable characterization data 

RNA consistency

Not done 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line A549 shows positivity in mitochondria.
More information
 

Antibody dilution

1:132 

Validation IF

Non-supportive: The subcellular location is not consistent with literature. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

159.8, 152.0, 148.2, 59.1 

Antibody dilution

1:660 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:5300 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
KIF16B-001
 
KIF16B-003
 
KIF16B-201
 
KIF16B-202