KIF16B

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA051198

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA051198 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

91 

Antigen sequence

KLVNLEKDLVQQKDILKKEVQEEQEILECLKCEHDKESRLLEKHDESVTD
VTEVPQDFEKIKPVEYRLQYKERQLQYLLQNHLPTLLEEKQ
 

Matching transcripts

KIF16B-001 - ENSP00000384164 [100%]
KIF16B-003 - ENSP00000347076 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells of tubules.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:600 

Literature conformity

Partly consistent with gene/protein characterization data 

RNA consistency

Mainly consistent with RNA expression data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line A549 shows positivity in mitochondria.
More information
 

Antibody dilution

1:132 

Validation IF

Non-supportive: The subcellular location is not consistent with experimental gene/protein characterization data, or conflicting with an independent antibody. 

         Western Blot

Image

 

Description

 

Target mass (kDa)

159.8, 152.0 

Antibody dilution

1:660 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:5300 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
KIF16B-001
 
KIF16B-003