RPGRIP1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA042955

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA042955 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

150 

Antigen sequence

MASPEVPIEAGQYRSKRKPPHGGERKEKEHQVVSYSRRKHGKRIGVQGKN
RMEYLSLNILNGNTPEQVNYTEWKFSETNSFIGDGFKNQHEEEEMTLSHS
ALKQKEPLHPVNDKESSEQGSEVSEAQTTDSDDVIVPPMSQKYPKADSEK
 

Matching transcripts

RPGRIP1-001 - ENSP00000382895 [100%]
RPGRIP1-002 - ENSP00000372391 [100%]
RPGRIP1-009 - ENSP00000451262 [100%]
RPGRIP1-010 - ENSP00000450445 [100%]
RPGRIP1-011 - ENSP00000451219 [100%]
RPGRIP1-201 - ENSP00000206660 [100%]
RPGRIP1-202 - ENSP00000309721 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human nasopharynx shows strong membranous, cytoplasmic and nuclear positivity in respiratory epithelial cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:325 

Literature conformity

Consistent with extensive gene/protein characterization data 

RNA consistency

Mainly not consistent with RNAseq data 

         Western Blot

Image

 

Description

 

Target mass (kDa)

146.7, 146.6, 142.8, 108.1, 87.0, 74.2, 70.1 

Antibody dilution

1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
RPGRIP1-001
 
RPGRIP1-002
 
RPGRIP1-009
 
RPGRIP1-010
 
RPGRIP1-011
 
RPGRIP1-201
 
RPGRIP1-202