ECHDC1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA035445

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA035445 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

78 

Antigen sequence

MALKQEMAKSLLKTASLSGRTKLLHQTGLSLYSTSHGFYEEEVKKTLQQF
PGGSIDLQKEDNGIGILTLNNPSRMNAF
 

Matching transcripts

ECHDC1-013 - ENSP00000436585 [100%]
ECHDC1-002 - ENSP00000434908 [92%]
ECHDC1-003 - ENSP00000436703 [92%]
ECHDC1-004 - ENSP00000357272 [92%]
ECHDC1-006 - ENSP00000402492 [92%]
ECHDC1-009 - ENSP00000357274 [92%]
ECHDC1-010 - ENSP00000401751 [92%]
ECHDC1-015 - ENSP00000420711 [92%]
ECHDC1-017 - ENSP00000357278 [92%]
ECHDC1-019 - ENSP00000433874 [92%]
ECHDC1-020 - ENSP00000435068 [92%]
ECHDC1-021 - ENSP00000434143 [92%]
ECHDC1-022 - ENSP00000435502 [92%]
ECHDC1-201 - ENSP00000311115 [92%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in tubular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:10 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

33.7, 33.0, 31.1, 19.9, 16.6, 15.9, 15.3, 14.7, 13.6, 9.3 

Antibody dilution

1:250 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 « 
 
ECHDC1-002
 
ECHDC1-003
 
ECHDC1-004
 
ECHDC1-006
 
ECHDC1-009
 
ECHDC1-010
 
ECHDC1-013
 
ECHDC1-015
 
ECHDC1-017
 
ECHDC1-019
 
ECHDC1-020
 
ECHDC1-021
 
ECHDC1-022
 
ECHDC1-201
 
 »