ACOT7

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA025735

 

Antibody HPA025762

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA025735 HPA025762 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

90 75 

Antigen sequence

RLCEFGRQASSRRLVAGQGCVGPRRGCCAPVQVVGPRADLPPCGACITGR
IMRPDDANVAGNVHGGTILKMIEEAGAIISTRHCNSQNGE
 
NKSMEIEVLVDADPVVDSSQKRYRAASAFFTYVSLSQEGRSLPVPQLVPE
TEDEKKRFEEGKGRYLQMKAKRQGH
 

Matching transcripts

ACOT7-001 - ENSP00000367086 [100%]
 ACOT7-001 - ENSP00000367086 [100%]
ACOT7-004 - ENSP00000367076 [100%]
ACOT7-005 - ENSP00000367073 [100%]
ACOT7-006 - ENSP00000354615 [100%]
ACOT7-009 - ENSP00000476610 [100%]
ACOT7-202 - ENSP00000439218 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells as well as cells in molecular layer.
More information
 Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in peripheral nerves.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:150 1:150 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. 

Antibody dilution

1:20  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

41.8 41.8, 40.5, 39.0, 37.4, 36.6, 29.6 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
ACOT7-001
 
ACOT7-004
 
ACOT7-005
 
ACOT7-006
 
ACOT7-009
 
ACOT7-202