CDC7

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA035831

 

Antibody CAB002669

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Lab Vision/NeoMarkers
 

Product name

HPA035831 MS-1888 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

12 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

83  

Antigen sequence

ATAQLQVGPEEKIALKHLIPTSHPIRIAAELQCLTVAGGQDNVMGVKYCF
RKNDHVVIAMPYLEHESFLDILNSLSFQEVREY
 
 

Matching transcripts

CDC7-001 - ENSP00000234626 [100%]
CDC7-002 - ENSP00000398077 [100%]
CDC7-201 - ENSP00000393139 [100%]
CDC7-202 - ENSP00000407477 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human stomach, upper shows moderate nuclear and cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human appendix shows strong nuclear positivity in lymphoid tissue.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:20 1:40 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

63.9, 60.7, 17.7 63.9, 60.7, 17.7 

Antibody dilution

1:250 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but excluded from the nucleoli.
More information
  

Antibody dilution

1:71  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CDC7-001
 
CDC7-002
 
CDC7-201
 
CDC7-202