PDGFB

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA011972

 

Antibody CAB011604

 

Antibody CAB018341

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Abcam plc
 Santa Cruz Biotechnology
 

Product name

HPA011972 ab23914 sc-127 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb msAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity Affinity 

Released in version

4 4 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide Synthetic peptide 

Length (aa)

133   

Antigen sequence

EELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELDLNMTRSHSGGELESL
ARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVE
VQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIV
 
 
 

Matching transcripts

PDGFB-001 - ENSP00000330382 [100%]
PDGFB-002 - ENSP00000370963 [100%]
PDGFB-003 - ENSP00000402306 [96%]
PDGFB-004 - ENSP00000405780 [96%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human lateral ventricle shows strong cytoplasmic positivity in granular pattern in neuronal cells.
More information
 Immunohistochemical staining of human skeletal muscle shows distinct cytoplasmic positivity in myocytes.
More information
 Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in islet cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:30 1:500 1:65 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400920)
More information
  Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

27.3, 25.5, 16.3, 15.5 27.3, 25.5, 16.3, 15.5 27.3, 25.5, 16.3, 15.5 

Antibody dilution

1:250 1:500 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Uncertain: No bands detected 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
   

Antibody dilution

1:3000   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
PDGFB-001
 
PDGFB-002
 
PDGFB-003
 
PDGFB-004