CDKL1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA059605

 

Antibody HPA065919

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA059605 HPA065919 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 14 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

42 46 

Antigen sequence

RHQQVFSTNQYFSGVKIPDPEDMEPLELKFPNISYPALGLLK
 
TLRKSRKHHCFTETSKLQYLPQLTGSSILPALDNKKYYCDTKKLNY
 

Matching transcripts

CDKL1-001 - ENSP00000379176 [100%]
CDKL1-003 - ENSP00000216378 [100%]
CDKL1-009 - ENSP00000435044 [100%]
CDKL1-010 - ENSP00000431449 [100%]
 CDKL1-001 - ENSP00000379176 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells.
More information
 Application not done for this antibody. 

Retrieval method

HIER pH6  

Antibody dilution

1:250  

Literature conformity

Partly consistent with gene/protein characterization data  

RNA consistency

Mainly consistent with RNA expression data  

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in vesicles & nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in vesicles & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:93 1:118 

Validation IF

Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

41.8, 31.9, 16.0, 7.9 41.8 

Antibody dilution

1:310 1:390 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3750 1:4700 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
CDKL1-001
 
CDKL1-003
 
CDKL1-009
 
CDKL1-010