ACIN1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000657

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA000657 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

132 

Antigen sequence

QEEPPAKLLDDLFRKTKAAPCIYWLPLTDSQIVQKEAERAERAKEREKRR
KEQEEEEQKEREKEAERERNRQLEREKRREHSRERDRERERERERDRGDR
DRDRERDRERGRERDRRDTKRHSRSRSRSTPV
 

Matching transcripts

ACIN1-001 - ENSP00000350073 [100%]
ACIN1-002 - ENSP00000345541 [100%]
ACIN1-003 - ENSP00000262710 [100%]
ACIN1-004 - ENSP00000380502 [100%]
ACIN1-006 - ENSP00000451328 [100%]
ACIN1-007 - ENSP00000451138 [100%]
ACIN1-022 - ENSP00000474349 [100%]
ACIN1-201 - ENSP00000405677 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human cerebellum shows strong nuclear positivity in purkinje cells and cells in granular layer.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:1000 

Validation IH

Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-251MG shows positivity in nucleus but not nucleoli.
More information
 

Antibody dilution

1:69 

Validation IF

Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

 

Description

 

Target mass (kDa)

151.9, 150.6, 147.4, 145.4, 70.9, 67.6, 67.5 

Antibody dilution

1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ACIN1-001
 
ACIN1-002
 
ACIN1-003
 
ACIN1-004
 
ACIN1-006
 
ACIN1-007
 
ACIN1-022
 
ACIN1-201