FMR1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA050118

 

Antibody HPA056084

 

Antibody CAB012444

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Abcam plc
 

Product name

HPA050118 HPA056084 ab27455 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

13 13 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Synthetic peptide 

Length (aa)

83 57  

Antigen sequence

FKGNDDHSRTDNRPRNPREAKGRTTDGSLQIRVDCNNERSVHTKTLQNTS
SEGSRLRTGKDRNQKKEKPDSVDGQQPLVNGVP
 
RIEAENEKNVPQEEEIMPPNSLPSNNSRVGPNAPEEKKHLDIKENSTHFS
QPNSTKV
 
 

Matching transcripts

FMR1-001 - ENSP00000359506 [100%]
FMR1-201 - ENSP00000218200 [100%]
FMR1-003 - ENSP00000395923 [80%]
FMR1-004 - ENSP00000359501 [80%]
FMR1-005 - ENSP00000359508 [80%]
FMR1-203 - ENSP00000413764 [80%]
 FMR1-001 - ENSP00000359506 [100%]
FMR1-003 - ENSP00000395923 [100%]
FMR1-004 - ENSP00000359501 [100%]
FMR1-005 - ENSP00000359508 [100%]
FMR1-201 - ENSP00000218200 [100%]
FMR1-202 - ENSP00000359502 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
More information
 Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
More information
 Immunohistochemical staining of human duodenum shows distinct cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:400 1:1200 1:300 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Mainly consistent with RNAseq data Mainly consistent with RNAseq data Mainly consistent with RNAseq data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm.
More information
 Application not done for this antibody. Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm.
More information
 

Antibody dilution

1:97  1:75 

Validation IF

Supportive: The subcellular location is supported by literature.  Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

71.2, 69.0, 66.8, 66.5, 65.8, 29.0 71.2, 69.0, 66.8, 66.5, 65.8, 61.0 71.2, 69.0, 66.8, 66.5, 65.8, 61.0, 34.1, 29.0 

Antibody dilution

1:480 1:280 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3900 1:3400  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
FMR1-001
 
FMR1-003
 
FMR1-004
 
FMR1-005
 
FMR1-201
 
FMR1-202
 
FMR1-203