HTATSF1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000504

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA000504 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

124 

Antigen sequence

GKDGDTQTDAGGEPDSLGQQPTDTPYEWDLDKKAWFPKITEDFIATYQAN
YGFSNDGASSSTANVEDVHARTAEEPPQEKAPEPTDARKKGEKRKAESGW
FHVEEDRNTNVYVSGLPPDITVDE
 

Matching transcripts

HTATSF1-001 - ENSP00000218364 [100%]
HTATSF1-002 - ENSP00000411381 [100%]
HTATSF1-003 - ENSP00000412420 [100%]
HTATSF1-201 - ENSP00000442699 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human adrenal gland shows strong nuclear positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:150 

Literature conformity

Consistent with extensive gene/protein characterization data 

RNA consistency

Consistent with RNAseq data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:35 

Validation IF

Supportive: The subcellular location is supported by literature. 

         siRNA

Image

 

Description

Signal downregulation > 25% by one siRNA.
More information
 

Antibody dilution

1:36 

Validation siRNA

Supportive: The siRNA validation is supportive. 

         Western Blot

Image

 

Description

 

Target mass (kDa)

85.9, 27.7, 25.2 

Antibody dilution

1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:1000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
HTATSF1-001
 
HTATSF1-002
 
HTATSF1-003
 
HTATSF1-201