CENPI

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA061297

 

Antibody CAB012356

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Abcam plc
 

Product name

HPA061297 ab31000 

Host species

Rabbit Rabbit 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

13 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

91  

Antigen sequence

PRNSKNISKHGQNNPVGDYEHADDQAEEDALQMAVGYFEKGPIKASQNKD
KTLEKHLKTVENVAWKNGLASEEIDILLNIALSGKFGNAVN
 
 

Matching transcripts

CENPI-001 - ENSP00000362017 [99%]
CENPI-004 - ENSP00000362018 [99%]
CENPI-201 - ENSP00000218507 [99%]
CENPI-202 - ENSP00000399274 [99%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Application not done for this antibody. Immunohistochemical staining of human cerebral cortex shows distinct cytoplasmic positivity in neuronal cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:200 

Literature conformity

 Partly consistent with extensive gene/protein characterization data 

RNA consistency

 Not done 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 219, 111, 83, 48, 32, 26, 17
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

86.7, 85.1, 59.8 86.7, 85.1, 59.8, 8.4, 5.0 

Antibody dilution

1:440 1:500 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus & cytoplasm.
More information
 Application not done for this antibody. 

Antibody dilution

1:133  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:5350  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CENPI-001
 
CENPI-004
 
CENPI-201
 
CENPI-202