BEX4

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA045105

 

Antibody HPA051935

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA045105 HPA051935 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

9 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

53 60 

Antigen sequence

WAIPNRHIEHNEARDDVERFVGQMMEIKRKTREQQMRHYMRFQTPEPDNH
YDF
 
ESKEELAANNLNGENAQQENEGGEQAPTQNEEESRHLGGGEGQKPGGNIR
RGRVRRLVPN
 

Matching transcripts

BEX4-001 - ENSP00000361780 [100%]
BEX4-002 - ENSP00000361776 [100%]
 BEX4-001 - ENSP00000361780 [100%]
BEX4-002 - ENSP00000361776 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human breast shows strong cytoplasmic and membranous positivity in glandular cells along with distinct extracellular positivity..
More information
 Application not done for this antibody. 

Retrieval method

HIER pH6  

Antibody dilution

1:900  

Literature conformity

No avaliable characterization data  

RNA consistency

Not done  

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

14.1 14.1 

Antibody dilution

1:250 1:390 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:6000 1:3100 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 

         Immunofluorescence

Image

  

Description

Application not done for this antibody. Immunofluorescent staining of human cell line PC-3 shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

 1:77 

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available. 
 

ANTIGEN VIEW

? »
 
 
 
BEX4-001
 
BEX4-002