ACP5

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA057655

 

Antibody HPA059463

 

Antibody CAB002584

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Novocastra
 

Product name

HPA057655 HPA059463 NCL-TRAP 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

13 13 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Not known 

Length (aa)

87 74  

Antigen sequence

GGVPNAPFHTAREMANAKEIARTVQILGADFILSLGDNFYFTGVQDINDK
RFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQI
 
THCLVKQLRPLLATYGVTAYLCGHDHNLQYLQDENGVGYVLSGAGNFMDP
SKRHQRKVPNGYLRFHYGTEDSLG
 
 

Matching transcripts

ACP5-001 - ENSP00000392374 [100%]
ACP5-002 - ENSP00000218758 [100%]
ACP5-003 - ENSP00000468767 [100%]
ACP5-006 - ENSP00000413456 [100%]
ACP5-011 - ENSP00000465127 [100%]
 ACP5-001 - ENSP00000392374 [100%]
ACP5-002 - ENSP00000218758 [100%]
ACP5-003 - ENSP00000468767 [100%]
ACP5-006 - ENSP00000413456 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human spleen shows strong cytoplasmic positivity in subset of cells in red pulp.
More information
 Immunohistochemical staining of human lung shows strong cytoplasmic positivity in macrophages.
More information
 Immunohistochemical staining of human lung shows strong cytoplasmic positivity in macrophages.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:100 1:400 1:3000 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Mainly consistent with RNAseq data Mainly consistent with RNAseq data Mainly consistent with RNAseq data 

         Immunofluorescence

Image

   

Description

Application not done for this antibody. Application not done for this antibody. Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm.
More information
 

Antibody dilution

  1:25 

Validation IF

  Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

36.6, 13.7 36.6 36.6, 13.7, 8.0, 6.5, 5.5, 0.8 

Antibody dilution

1:80 1:290 1:500 

Validation WB

Uncertain: No bands detected Uncertain: No bands detected Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:550 1:3450  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
ACP5-001
 
ACP5-002
 
ACP5-003
 
ACP5-006
 
ACP5-011