FLT1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA011740

 

Antibody HPA014290

 

Antibody CAB068189

 

Antibody CAB068190

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
 Atlas Antibodies
 

Product name

HPA011740 HPA014290 AMAb90703 AMAb90704 

Host species

Rabbit Rabbit Mouse Mouse 

Clonality

pAb pAb mAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G Protein A/G 

Released in version

5 5 13 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein Recombinant protein 

Length (aa)

121 106   

Antigen sequence

LNLTIMNVSLQDSGTYACRARNVYTGEEILQKKEITIRDQEAPYLLRNLS
DHTVAISSSTTLDCHANGVPEPQITWFKNNHKIQQEPGIILGPGSSTLFI
ERVTEEDEGVYHCKATNQKGS
 
IWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQI
STPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQ
SNSHAN
 
 
 

Matching transcripts

FLT1-001 - ENSP00000282397 [100%]
 FLT1-001 - ENSP00000282397 [100%]
FLT1-201 - ENSP00000442630 [100%]
FLT1-203 - ENSP00000437631 [100%]
   

Other gene match

    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human placenta shows distinct positivity in vessels.
More information
 Immunohistochemical staining of human urinary bladder shows distinct positivity in vessels.
More information
 Immunohistochemical staining of human placenta shows cytoplasmic positivity in trophoblastic cells.
More information
 Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:600 1:80 1:300 1:800 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Mainly consistent with RNAseq data Not at all consistent with RNAseq data Mainly consistent with RNAseq data Mainly consistent with RNAseq data 

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

150.8 150.8, 82.1, 60.9 150.8, 82.1, 63.0, 60.9, 41.2 150.8, 82.1, 63.0, 60.9, 41.2 

Antibody dilution

1:250 1:250 1:1000 1:1000 

Validation WB

Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:3000 1:500   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).   
 

ANTIGEN VIEW

? »
 
 
 
FLT1-001
 
FLT1-201
 
FLT1-203