PRSS54

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA040750

 

Antibody HPA041549

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA040750 HPA041549 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

8 8 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

93 92 

Antigen sequence

KTECGSHTKEETKTACLGDPGSPMMCQLQQFDLWVLRGVLNFGGETCPGL
FLYTKVEDYSKWITSKAERAGPPLSSLHHWEKLISFSHHGPNA
 
VFYGPDPKEGLVSSMEFPWVVSLQDSQYTHLAFGCILSEFWVLSIASAIQ
NRKDIVVIVGISNMDPSKIAHTEYPVNTIIIHEDFDNNSMSN
 

Matching transcripts

PRSS54-001 - ENSP00000455024 [100%]
PRSS54-002 - ENSP00000437705 [100%]
PRSS54-003 - ENSP00000455921 [100%]
PRSS54-201 - ENSP00000219301 [100%]
 PRSS54-001 - ENSP00000455024 [100%]
PRSS54-005 - ENSP00000455055 [100%]
PRSS54-201 - ENSP00000219301 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.
More information
 Immunohistochemical staining of human testis shows strong cytoplasmic positivity in subset of cells in seminiferus ducts
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:60 1:100 

Validation IH

Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns and there is no available gene/protein characterization data Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns and there is no available gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm.
More information
 

Antibody dilution

1:30 1:55 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

43.8, 33.3, 22.9 43.8, 20.3 

Antibody dilution

1:250 1:250 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
PRSS54-001
 
PRSS54-002
 
PRSS54-003
 
PRSS54-005
 
PRSS54-201