TSC2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA030409

 

Antibody HPA049679

 

Antibody CAB002225

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Novocastra
 

Product name

HPA030409 HPA049679 NCL-TUBERIN 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

6 13 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Not known 

Length (aa)

88 85  

Antigen sequence

SVLPSFYQAMACPNEVVSYEIVLSITRLIKKYRKELQVVAWDILLNIIER
LLQQLQTLDSPELRTIVHDLLTTVEELCDQNEFHGSQE
 
SQVHHSRSNPTDIYPSKWIARLRHIKRLRQRICEEAAYSNPSLPLVHPPS
HSKAPAQTPAEPTPGYEVGQRKRLISSVEDFTEFV
 
 

Matching transcripts

TSC2-001 - ENSP00000219476 [100%]
TSC2-003 - ENSP00000384468 [100%]
TSC2-004 - ENSP00000344383 [100%]
TSC2-006 - ENSP00000454487 [100%]
TSC2-007 - ENSP00000371978 [100%]
TSC2-017 - ENSP00000399232 [100%]
TSC2-201 - ENSP00000248099 [100%]
 TSC2-001 - ENSP00000219476 [100%]
TSC2-003 - ENSP00000384468 [100%]
TSC2-004 - ENSP00000344383 [100%]
TSC2-006 - ENSP00000454487 [100%]
TSC2-007 - ENSP00000371978 [100%]
TSC2-017 - ENSP00000399232 [100%]
TSC2-019 - ENSP00000455817 [100%]
TSC2-201 - ENSP00000248099 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human cerebral cortex shows distinct cytoplasmic positivity in neuronal cells.
More information
 Application not done for this antibody. Immunohistochemical staining of human cerebral cortex shows distinct positivity in subsets of neuronal cells.
More information
 

Retrieval method

HIER pH6  HIER pH6 

Antibody dilution

1:70  1:35 

Literature conformity

Consistent with extensive gene/protein characterization data  Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done  Not done 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

200.6, 198.1, 195.8, 194.4, 193.2, 189.3, 188.0 200.6, 198.1, 195.8, 194.4, 193.2, 189.3, 188.0, 58.6 200.6, 198.1, 195.8, 194.4, 193.2, 189.3, 188.0, 58.6, 22.0, 14.1, 11.8, 3.6, 3.1 

Antibody dilution

1:250 1:120 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
More information
 Immunofluorescent staining of human cell line HeLa shows positivity in cytoplasm.
More information
 Application not done for this antibody. 

Antibody dilution

1:100 1:25  

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature.  

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000 1:1000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
TSC2-001
 
TSC2-003
 
TSC2-004
 
TSC2-006
 
TSC2-007
 
TSC2-017
 
TSC2-019
 
TSC2-201