CLUAP1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA036976

 

Antibody HPA044191

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA036976 HPA044191 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

101 92 

Antigen sequence

VLYNAMKTKGMEGSEIVEEDVNKFKFDLGSKIADLKAARQLASEITSKGA
SLYDLLGMEVELREMRTEAIARPLEINETEKVMRIAIKEILTQVQKTKDL
L
 
SDEANLEAKIEKRKLELERNRKRLETLQSVRPCFMDEYEKTEEELQKQYD
TYLEKFQNLTYLEQQLEDHHRMEQERFEEAKNTLCLIQNKLK
 

Matching transcripts

CLUAP1-001 - ENSP00000460850 [100%]
CLUAP1-002 - ENSP00000344392 [100%]
CLUAP1-003 - ENSP00000460706 [100%]
 CLUAP1-001 - ENSP00000460850 [100%]
CLUAP1-002 - ENSP00000344392 [100%]
CLUAP1-003 - ENSP00000460706 [100%]
CLUAP1-004 - ENSP00000460889 [100%]
CLUAP1-010 - ENSP00000458513 [100%]
CLUAP1-201 - ENSP00000388642 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
More information
  

Retrieval method

HIER pH6  

Antibody dilution

1:400  

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data  

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

50.1, 48.1, 44.6 50.1, 48.1, 44.6, 29.1, 18.1 

Antibody dilution

1:250 1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:12000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunofluorescence

Image

  

Description

 Immunofluorescent staining of human cell line A-431 shows positivity in vesicles & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

 1:200 

Validation IF

 Supportive: The subcellular location is supported by literature. 
 

ANTIGEN VIEW

? »
 
 
 
CLUAP1-001
 
CLUAP1-002
 
CLUAP1-003
 
CLUAP1-004
 
CLUAP1-010
 
CLUAP1-201