ISYNA1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA007931

 

Antibody HPA008232

 

Antibody CAB020720

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 SDIX
 

Product name

HPA007931 HPA008232 3035.00.02 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

11 11 11 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Genetic immunization 

Length (aa)

119 109  

Antigen sequence

SVLVDFLIGSGLKTMSIVSYNHLGNNDGENLSAPLQFRSKEVSKSNVVDD
MVQSNPVLYTPGEEPDHCVVIKYVPYVGDSKRALDEYTSELMLGGTNTLV
LHNTCEDSLLAAPIMLDLA
 
VYIPEFIAANQSARADNLIPGSRAQQLEQIRRDIRDFRSSAGLDKVIVLW
TANTERFCEVIPGLNDTAENLLRTIELGLEVSPSTLFAVASILEGCAFLN
GSPQNTLVP
 
 

Matching transcripts

ISYNA1-001 - ENSP00000415458 [100%]
ISYNA1-002 - ENSP00000337746 [100%]
ISYNA1-006 - ENSP00000475677 [100%]
ISYNA1-201 - ENSP00000315147 [100%]
ISYNA1-202 - ENSP00000444679 [100%]
ISYNA1-011 - ENSP00000464528 [83%]
 ISYNA1-001 - ENSP00000415458 [100%]
ISYNA1-002 - ENSP00000337746 [100%]
ISYNA1-006 - ENSP00000475677 [100%]
ISYNA1-202 - ENSP00000444679 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferus ducts.
More information
 Immunohistochemical staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferus ducts.
More information
 Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:600 1:250 1:1700 

Literature conformity

No avaliable characterization data No avaliable characterization data No avaliable characterization data 

RNA consistency

Not done Not done Not done 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line HEK 293 shows positivity in nucleus & cytoplasm.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:49   

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.   

         Western Blot

Image

   

Description

 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

61.1, 55.1, 47.1, 44.8, 38.8, 25.2 61.1, 55.1, 47.1, 44.8 61.1, 55.1, 47.1, 44.8, 38.8, 25.2, 19.5, 16.3, 16.1, 5.1 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
ISYNA1-001
 
ISYNA1-002
 
ISYNA1-006
 
ISYNA1-011
 
ISYNA1-201
 
ISYNA1-202