CAV1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA049326

 

Antibody CAB003791

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Epitomics
 

Product name

HPA049326 1249-1 

Host species

Rabbit Rabbit 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Supernatant 

Released in version

13 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

41  

Antigen sequence

LIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI
 
 

Matching transcripts

CAV1-001 - ENSP00000339191 [100%]
CAV1-003 - ENSP00000377110 [100%]
CAV1-004 - ENSP00000377111 [100%]
CAV1-006 - ENSP00000377113 [100%]
CAV1-008 - ENSP00000384348 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human smooth muscle shows moderate membranous positivity in smooth muscle cells.
More information
 Immunohistochemical staining of human smooth muscle shows moderate cytoplasmic positivity in smooth muscle cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:200 1:200 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Consistent with RNAseq data Consistent with RNAseq data 

         Immunofluorescence

Image

  

Description

Application not done for this antibody. Immunofluorescent staining of human cell line A-431 shows positivity in the Golgi apparatus.
More information
 

Antibody dilution

 1:50 

Validation IF

 Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

20.5, 19.2, 17.0 20.5, 19.2, 17.0, 15.9, 8.8 

Antibody dilution

1:80 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:500  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 
CAV1-001
 
CAV1-003
 
CAV1-004
 
CAV1-006
 
CAV1-008