GRB10

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA027502

 

Antibody HPA031818

 

Antibody CAB019423

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Cell Signaling Technology, Inc
 

Product name

HPA027502 HPA031818 3702 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

6 13 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Synthetic peptide 

Length (aa)

79 94  

Antigen sequence

FSGQTGRVIENPAEAQSAALEEGHAWRKRSTRMNILGSQSPLHPSTLSTV
IHRTQHWFHGRISREESHRIIKQQGLVDG
 
LHHPYYQDKVEQTPRSQQDPAGPGLPAQSDRLANHQEDDVDLEALVNDMN
ASLESLYSACSMQSDTVPLLQNGQHARSQPRASGPPRSIQPQVS
 
 

Matching transcripts

GRB10-001 - ENSP00000385544 [100%]
GRB10-002 - ENSP00000385748 [100%]
GRB10-003 - ENSP00000385770 [100%]
GRB10-004 - ENSP00000385366 [100%]
GRB10-005 - ENSP00000349818 [100%]
GRB10-006 - ENSP00000385189 [100%]
GRB10-007 - ENSP00000385046 [100%]
GRB10-201 - ENSP00000338543 [100%]
GRB10-202 - ENSP00000381790 [100%]
GRB10-203 - ENSP00000381793 [100%]
GRB10-204 - ENSP00000406716 [100%]
 GRB10-003 - ENSP00000385770 [100%]
GRB10-005 - ENSP00000349818 [100%]
GRB10-203 - ENSP00000381793 [100%]
GRB10-001 - ENSP00000385544 [93%]
GRB10-014 - ENSP00000413023 [93%]
GRB10-204 - ENSP00000406716 [93%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.
More information
 Application not done for this antibody. Immunohistochemical staining of human rectum shows strong granular cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6  HIER pH6 

Antibody dilution

1:25  1:40 

Literature conformity

Partly consistent with extensive gene/protein characterization data  Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done  Not done 

         Western Blot

Image

   

Description

  Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

67.2, 66.5, 62.0, 60.8 67.2, 66.5, 62.0, 12.4 67.2, 66.5, 62.0, 60.8, 12.7, 12.4 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Only bands not corresponding to the predicted size Uncertain: No bands detected 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:500 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  

         Immunofluorescence

Image

   

Description

Application not done for this antibody. Immunofluorescent staining of human cell line A549 shows positivity in nuclear membrane & vesicles.
More information
 Application not done for this antibody. 

Antibody dilution

 1:30  

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available.  
 

ANTIGEN VIEW

? »
 
 
 « 
 
GRB10-001
 
GRB10-002
 
GRB10-003
 
GRB10-004
 
GRB10-005
 
GRB10-006
 
GRB10-007
 
GRB10-014
 
GRB10-201
 
GRB10-202
 
GRB10-203
 
GRB10-204
 
 »