GRB10

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA027502

 

Antibody CAB019423

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Cell Signaling Technology, Inc
 

Product name

HPA027502 3702 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

6 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

79  

Antigen sequence

FSGQTGRVIENPAEAQSAALEEGHAWRKRSTRMNILGSQSPLHPSTLSTV
IHRTQHWFHGRISREESHRIIKQQGLVDG
 
 

Matching transcripts

GRB10-001 - ENSP00000385544 [100%]
GRB10-002 - ENSP00000385748 [100%]
GRB10-003 - ENSP00000385770 [100%]
GRB10-004 - ENSP00000385366 [100%]
GRB10-005 - ENSP00000349818 [100%]
GRB10-006 - ENSP00000385189 [100%]
GRB10-007 - ENSP00000385046 [100%]
GRB10-201 - ENSP00000338543 [100%]
GRB10-202 - ENSP00000381790 [100%]
GRB10-203 - ENSP00000381793 [100%]
GRB10-204 - ENSP00000406716 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.
More information
 Immunohistochemical staining of human rectum shows strong granular cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:25 1:40 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

67.2, 66.5, 62.0, 60.8 67.2, 66.5, 62.0, 60.8, 12.7, 12.4 

Antibody dilution

1:250 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 « 
 
GRB10-001
 
GRB10-002
 
GRB10-003
 
GRB10-004
 
GRB10-005
 
GRB10-006
 
GRB10-007
 
GRB10-201
 
GRB10-202
 
GRB10-203
 
GRB10-204
 
 »